PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo8G0042400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family CPP
Protein Properties Length: 446aa    MW: 49371.4 Da    PI: 9.579
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo8G0042400genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.31.7e-145997241
             TCR  2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41
                    ++k+C+Ck+skClk+YCeCfa+g++C++ CkC++C+N+ e
  Spipo8G0042400 59 KQKQCSCKNSKCLKLYCECFASGVYCEK-CKCTNCFNTVE 97
                    89*************************9.********987 PP

2TCR50.15.4e-16133172140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     k+++gC+Ckks Clk+YCeCf+a+ +Cse+CkC dCkN+e
  Spipo8G0042400 133 KHNEGCHCKKSGCLKNYCECFQAKIFCSEDCKCFDCKNHE 172
                     5899**********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.1E-155898IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163432.1559173IPR005172CRC domain
PfamPF036382.8E-116095IPR005172CRC domain
SMARTSM011141.5E-18133174IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.3E-12136171IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 446 aa     Download sequence    Send to blast
MRHFWQRSPR DRSMGFSRNN INSFTCGDRP ASQSDSLPNI SSIAGVRSGY DGKDETPKKQ  60
KQCSCKNSKC LKLYCECFAS GVYCEKCKCT NCFNTVENKA AKHEAVEALL ERNRSGFRLK  120
IAMEEAEPPL VGKHNEGCHC KKSGCLKNYC ECFQAKIFCS EDCKCFDCKN HEASAQIRAV  180
FHGENGGHTT FIQHVANSTI TGATGSSGHA SPPASKRKKS EEALFSSGIK DSSVHGLGQS  240
PLANHLKRTT ASLGYMPRAV GPANLGPTKV TYRPLLADVI KREDVKQLCK LLVVVSGDAA  300
QALGAHEDEL LLSLLHILGN GMLMAYCFSE NSKRRRLQRR QPQKPKSILH PPLLHQARAR  360
TRAEEHQTTR EGQATVPALQ MQIIWPQERL GLGRTKTGAA SGASSRQRTT SEVYLQQERC  420
VLAEFRDCLR NLTMFGKLKP KDRRE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1332336KRRRL
2333340RRRLQRRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010249672.11e-111PREDICTED: protein tesmin/TSO1-like CXC 5
TrEMBLA0A0K9NTR31e-109A0A0K9NTR3_Z
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47303657
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.19e-81Tesmin/TSO1-like CXC domain-containing protein